PDB entry 1kqz

View 1kqz on RCSB PDB site
Description: hevamine mutant d125a/e127a/y183f in complex with tetra-nag
Deposited on 2002-01-08, released 2002-01-23
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-23, with a file datestamp of 2002-01-23.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.168
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1kqza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kqzA (A:)
    ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
    sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
    gidfaiahgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
    qffnnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
    peikkspkyggvmlwskfyddkngysssildsv