PDB entry 1kqw

View 1kqw on RCSB PDB site
Description: Crystal structure of holo-CRBP from zebrafish
Class: transport protein
Keywords: retinol, vitamin A, retinol-binding, TRANSPORT PROTEIN
Deposited on 2002-01-08, released 2002-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.165
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cellular retinol-binding protein
  Species: Danio rerio [TaxId:7955]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q8UVG6 (0-133)
  Domains in SCOPe 2.08: d1kqwa_
• Heterogens: RTL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kqwA (A:)
  padfngtwemlsndnfedvmkaldidfatrkiavhlkqtkvivqngdkfetktlstfrny
  evnfvigeefdeqtkgldnrtvktlvkwdgdklvcvqkgekenrgwkqwiegdllhleih
  cqdkvchqvfkkkn