PDB entry 1kqr

View 1kqr on RCSB PDB site
Description: Crystal Structure of the Rhesus Rotavirus VP4 Sialic Acid Binding Domain in Complex with 2-O-methyl-alpha-D-N-acetyl neuraminic acid
Class: Viral protein
Keywords: rotavirus, VP4, VP8*, spike protein, outer capsid, sialic acid, hemagglutinin, cell attachment, neutralization antigen, lectin, galectin fold, Viral protein
Deposited on 2002-01-07, released 2002-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.169
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp4
    Species: Rhesus rotavirus [TaxId:10969]
    Gene: segment 4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kqra_
  • Heterogens: SO4, MNA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1kqrA (A:)
gspefpgrenlyfqgrepvldgpyqpttfnppvdywmllaptaagvvvegtnntdrwlat
ilvepnvtsetrsytlfgtqeqitianasqtqwkfidvvkttqngsysqygplqstpkly
avmkhngkiytyngetpnvttkyysttnydsvnmtafcdfyiipreeestcteyinngl

    Sequence, based on observed residues (ATOM records): (download) 
    >1kqrA (A:)
ldgpyqpttfnppvdywmllaptaagvvvegtnntdrwlatilvepnvtsetrsytlfgt
qeqitianasqtqwkfidvvkttqngsysqygplqstpklyavmkhngkiytyngetpnv
ttkyysttnydsvnmtafcdfyiipreeestcteyinngl