PDB entry 1kqr

View 1kqr on RCSB PDB site
Description: crystal structure of the rhesus rotavirus vp4 sialic acid binding domain in complex with 2-o-methyl-alpha-d-n-acetyl neuraminic acid
Deposited on 2002-01-07, released 2002-03-27
The last revision prior to the SCOP 1.61 freeze date was dated 2002-03-27, with a file datestamp of 2002-03-27.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.169
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1kqra_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kqrA (A:)
  ldgpyqpttfnppvdywmllaptaagvvvegtnntdrwlatilvepnvtsetrsytlfgt
  qeqitianasqtqwkfidvvkttqngsysqygplqstpklyavmkhngkiytyngetpnv
  ttkyysttnydsvnmtafcdfyiipreeestcteyinngl