PDB entry 1kqn

View 1kqn on RCSB PDB site
Description: Crystal structure of NMN/NaMN adenylyltransferase complexed with NAD
Class: transferase
Keywords: nucleotidyltransferase superfamily
Deposited on 2002-01-07, released 2003-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.218
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kqna_
  • Chain 'B':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kqnb_
  • Chain 'C':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kqnc_
  • Chain 'D':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kqnd_
  • Chain 'E':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kqne_
  • Chain 'F':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kqnf_
  • Heterogens: NAD, XE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kqnA (A:)
    mensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkgl
    ipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptl
    erpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivan
    yglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylv
    pdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqnA (A:)
    ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
    rvimaelatknskwvevdtweslqkewketlkvlrhhqekleaavpkvkllcgadllesf
    avpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandiss
    tkirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrnta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kqnB (B:)
    mensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkgl
    ipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptl
    erpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivan
    yglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylv
    pdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqnB (B:)
    ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
    rvimaelatknskwvevdtweslqkewketlkvlrhhqekleavpkvkllcgadllesfa
    vpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisst
    kirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrnta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kqnC (C:)
    mensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkgl
    ipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptl
    erpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivan
    yglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylv
    pdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqnC (C:)
    ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
    rvimaelatknskwvevdtweslqkewketlkvlrhhqekleavpkvkllcgadllesfa
    vpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisst
    kirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrnta
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kqnD (D:)
    mensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkgl
    ipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptl
    erpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivan
    yglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylv
    pdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqnD (D:)
    ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
    rvimaelatknskwvevdtweslqkewketlkvlrhhqekleavpkvkllcgadllesfa
    vpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisst
    kirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrnta
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1kqnE (E:)
    mensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkgl
    ipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptl
    erpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivan
    yglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylv
    pdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqnE (E:)
    ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
    rvimaelatknskwvevdtweslqkewketlkvlrhhqekleaavpkvkllcgadllesf
    avpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandiss
    tkirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrnta
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1kqnF (F:)
    mensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkgl
    ipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptl
    erpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivan
    yglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylv
    pdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqnF (F:)
    ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
    rvimaelatknskwvevdtweslqkewketlkvlrhhqekleavpkvkllcgadllesfa
    vpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisst
    kirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrnta