PDB entry 1kqm

View 1kqm on RCSB PDB site
Description: scallop myosin s1-amppnp in the actin-detached conformation
Class: contractile protein
Keywords: actin-detached, Myosin, Mechanics of MOTOR
Deposited on 2002-01-07, released 2002-11-20
The last revision prior to the SCOP 1.75 freeze date was dated 2002-11-20, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.277
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin heavy chain
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kqma1, d1kqma2
  • Chain 'B':
    Compound: myosin regulatory light chain
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kqmb_
  • Chain 'C':
    Compound: myosin essential light chain
    Species: Aequipecten irradians
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1kqmc_
  • Heterogens: CA, MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kqmA (A:)
    mnidfsdpdfqylavdrkklmkeqtaafdgkkncwvpdekegfasaeiqsskgdeitvki
    vadsstrtvkkddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfc
    iavnpyrrlpiytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesga
    gktentkkvimylakvacavkkkdeeasdkkegsledqiiqanpvleaygnakttrnnns
    srfgkfirihfgptgkiagadietylleksrvtyqqsaernyhifyqicsnaipelndvm
    lvtpdsglysfinqgcltvdniddveefklcdeafdilgftkeekqsmfkctasilhmge
    mkfkqrpreeqaesdgtaeaekvaflcginagdllkallkpkvkvgtemvtkgqnmnqvv
    nsvgalakslydrmfnwlvrrvnktldtkakrnyyigvldiagfeifdfnsfeqlcinyt
    nerlqqffnhhmfileqeeykkegiawefidfgmdlqmcidliekpmgilsileeecmfp
    kaddksfqdklyqnhmgknrmftkpgkptrpnqgpahfelhhyagnvpysitgwleknkd
    pinenvvallgaskeplvaelfkapeepagggkkkkgkssafqtisavhreslnklmknl
    ysthphfvrciipnelkqpglvdaelvlhqlqcngvlegiricrkgfpsrliysefkqry
    silapnaipqgfvdgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderlsk
    iismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqmA (A:)
    fsdpdfqylamkeqtaafdgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvk
    kddiqsmnppkfekledmanmtylneasvlynlrsrytsgliytysglfciavnpyrrlp
    iytdsviakyrgkrkteipphlfsvadnayqnmvtdrenqsclitgesgagktentkkvi
    mylakvacavgsledqiiqanpvleaygnakttrnnnssrfgkfirihfgptgkiagadi
    etylleksrvtyqqsaernyhifyqicsnaipelndvmlvtpdsglysfinqgcltvdni
    ddveefklcdeafdilgftkeekqsmfkctasilhmgemkfkeqaesdgtaeaekvaflc
    ginagdllkallkpkvkvmvtkgqnmnqvvnsvgalakslydrmfnwlvrrvnktldtka
    krnyyigvldiagfeifdfnsfeqlcinytnerlqqffnhhmfileqeeykkegiawedf
    gmdlqmcidliekpmgilsileeeckaddksfqdklyqnhmgknrmftkpgkptrpnqgp
    ahfelhhyagnvpysitgwleknkdpinenvvallgaskeplvaelfkapeepafqtisa
    vhreslnklmknlysthphfvrciipnelkqpglvdaelvlhqlqcngvlekgfpsrliy
    sefkqrysilapnaidgktvsekilaglqmdpaeyrlgttkvffkagvlgnleemrderl
    skiismfqahirgylirkaykklqdqriglsviqrnirkwlvlrnwqwwklyskvkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kqmB (B:)
    adkaasgvltklpqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltaml
    keapgplnftmflsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnf
    nkdemrmtfkeapveggkfdyvkftamikgsgeeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqmB (B:)
    pqkqiqemkeafsmidvdrdgfvskedikaiseqlgrapddkeltamlkeapgplnftmf
    lsifsdklsgtdseetirnafamfdeqetkklnieyikdllenmgdnfnkdemrmtfkea
    pveggkfdyvkftamikgsgee
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kqmC (C:)
    pklsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmge
    kslpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsde
    dvdeiikltdlqedlegnvkyedfvkkvmagpypdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kqmC (C:)
    klsqdeiddlkdvfelfdfwdgrdgavdafklgdvcrclginprnedvfavggthkmgek
    slpfeeflpayeglmdceqgtfadymeafktfdregqgfisgaelrhvltalgerlsded
    vdeiikltdlqedlegnvkyedfvkkvmagpyp