PDB entry 1kqk

View 1kqk on RCSB PDB site
Description: Solution Structure of the N-terminal Domain of a Potential Copper-translocating P-type ATPase from Bacillus subtilis in the Cu(I)loaded State
Class: hydrolase
Keywords: CopA, NMR, folding, P-type ATPase, copper transporting protein, HYDROLASE
Deposited on 2002-01-07, released 2002-04-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potential copper-transporting ATPase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yvgX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O32220 (1-75)
      • initiating methionine (0)
      • see remark 999 (76-79)
    Domains in SCOPe 2.06: d1kqka_
  • Heterogens: CU1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1kqkA (A:)
mtekaefdiegmtcaacanriekrlnkiegvanapvnfaletvtveynpkeasvsdlkea
vdklgyklklkgeqdsiegr