PDB entry 1kqj

View 1kqj on RCSB PDB site
Description: Crystal Structure of a Mutant of MutY Catalytic Domain
Class: hydrolase
Keywords: all alpha-helix, two lobes, N-terminus contains Helix-hinge-Helix (HhH) and C-terminal domain contains iron sulfur cluster, HYDROLASE
Deposited on 2002-01-06, released 2002-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.191
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: A/G-specific adenine glycosylase
  Species: Escherichia coli [TaxId:562]
  Gene: mutY
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17802 (0-224)
    • engineered (198)
  Domains in SCOPe 2.07: d1kqja_
• Heterogens: SO4, SF4, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kqjA (A:)
  mqasqfsaqvldwydkygrktlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
  tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
  tagailslslgkhfpildgnvkrvlarcyavsgwpgkkevenklwslseqvtpavgverf
  nqammdlgamictrskpkhslcplqngciaaannswalypgkkpk