PDB entry 1kqi

View 1kqi on RCSB PDB site
Description: NMR Solution Structure of the trans Pro30 Isomer of ACTX-Hi:OB4219
Class: toxin
Keywords: Hadronyche infensa, funnel web, spider venom, cis-trans isomerisation, disulfide rich, cystine knot, solution structure, NMR spectroscopy, TOXIN
Deposited on 2002-01-06, released 2002-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ACTX-Hi:OB4219
  Species: Hadronyche infensa [TaxId:153481]
  Database cross-references and differences (RAF-indexed):
  • PDB 1KQI (0-37)
  Domains in SCOPe 2.08: d1kqia_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kqiA (A:)
  kclaeaadcspwsgdscckpylcsciffypcscrpkgw