PDB entry 1kq9

View 1kq9 on RCSB PDB site
Description: Human methionine aminopeptidase type II in complex with L-methionine
Deposited on 2002-01-04, released 2003-12-09
The last revision prior to the SCOP 1.67 freeze date was dated 2003-12-09, with a file datestamp of 2003-12-09.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.179
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kq9A (A:)
    magveevaasgshlngdldpddreegaastaeeaakkkrrkkkkskgpsaageqepdkes
    gasvdevarqlersaledkerdeddedgdgdgdgatgkkkkkkkkkrgpkvqtdppsvpi
    cdlypngvfpkgqeceypptqdgrtaawrttseekkaldqaseeiwndfreaaeahrqvr
    kyvmswikpgmtmieicekledcsrklikenglnaglafptgcslnncaahytpnagdtt
    vlqyddickidfgthisgriidcaftvtfnpkydtllkavkdatntgikcagidvrlcdv
    geaiqevmesyeveidgktyqvkpirnlnghsigqyrihagktvpiikggeatrmeegev
    yaietfgstgkgvvhddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwl
    drlgeskylmalknlcdlgivdpypplcdikgsytaqfehtillrptckevvsrgddy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq9A (A:)
    qtpsvpicdlypngvfpkgqeceypkkaldqaseeiwndfreaaeahrqvrkyvmswikp
    gmtmieicekledcsrklikenglnaglafptgcslnncaahytpnagdttvlqyddick
    idfgthisgriidcaftvtfnpkydtllkavkdatntgikcagidvrlcdvgeaiqevme
    syeveidgktyqvkpirnlnghsigqyrihagktvpiikggeatrmeegevyaietfgst
    gkgvvhddmecshymknfdvghvpirlprtkhllnvinenfgtlafcrrwldrlgeskyl
    malknlcdlgivdpypplcdikgsytaqfehtillrptckevvsrgddy