PDB entry 1kq8

View 1kq8 on RCSB PDB site
Description: Solution Structure of Winged Helix Protein HFH-1
Class: transcription
Keywords: Winged Helix Protein, HFH-1, NMR, Structure
Deposited on 2002-01-04, released 2002-01-22
The last revision prior to the SCOP 1.75 freeze date was dated 2003-02-25, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hepatocyte nuclear factor 3 forkhead homolog 1
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q63244
      • conflict (11)
    Domains in SCOP 1.75: d1kq8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1kq8A (A:)
pkppysyialitmairdsaggrltlaeineylmgkfpffrgsytgwrnsvrhnlslndcf
vkvlrdpsrpwgkdnywmlnpnseytfadgvfrrrryrls

    Sequence, based on observed residues (ATOM records): (download) 
    >1kq8A (A:)
yialitmairdsaggrltlaeineylmgkfpffrgsytgwrnsvrhnlslndcfvkvlrd
psrpwgkdnywmlnp