PDB entry 1kq8

View 1kq8 on RCSB PDB site
Description: solution structure of winged helix protein hfh-1
Deposited on 2002-01-04, released 2002-01-22
The last revision prior to the SCOP 1.69 freeze date was dated 2002-03-18, with a file datestamp of 2002-03-18.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1kq8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kq8A (A:)
    pkppysyialitmairdsaggrltlaeineylmgkfpffrgsytgwrnsvrhnlslndcf
    vkvlrdpsrpwgkdnywmlnpnseytfadgvfrrrryrls
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq8A (A:)
    yialitmairdsaggrltlaeineylmgkfpffrgsytgwrnsvrhnlslndcfvkvlrd
    psrpwgkdnywmlnp