PDB entry 1kq6

View 1kq6 on RCSB PDB site
Description: p47phox PX domain
Class: protein binding
Keywords: ALPHA BETA, PX DOMAIN, NADPH oxidase, PROTEIN BINDING
Deposited on 2002-01-04, released 2003-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.18 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neutrophil cytosol factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14598 (Start-140)
      • modified residue (26)
      • modified residue (56)
      • modified residue (101)
      • modified residue (140)
    Domains in SCOPe 2.08: d1kq6a_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kq6A (A:)
    mgdtfirhiallgfekrfvpsqhyvymflvkwqdlsekvvyrrfteiyefhktlkemfpi
    eagainpenriiphlpapkwfdgqraaenrqgtlteycstlmslptkisrcphlldffkv
    rpddlklptdnqtkkpetylm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq6A (A:)
    gdtfirhiallgfekrfvpsqhyvymflvkwqdlsekvvyrrfteiyefhktlkemfpie
    againpenriiphlpapkwfdgqraaenrqgtlteycstlmslptkisrcphlldffkvr
    pddlklptdnqtkkpetylm