PDB entry 1kq3

View 1kq3 on RCSB PDB site
Description: crystal structure of a glycerol dehydrogenase (tm0423) from thermotoga maritima at 1.5 a resolution
Deposited on 2002-01-03, released 2002-02-27
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-24, with a file datestamp of 2002-07-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.173
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1kq3a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kq3A (A:)
    hmitttifpgryvqgagainileeelsrfgerafvviddfvdknvlgenffssftkvrvn
    kqifggecsdeeierlsglveeetdvvvgigggktldtakavayklkkpvvivptiastd
    apcsalsviytpngefkrylflprnpdvvlvdteivakaparflvagmgdalatwfeaes
    ckqkyapnmtgrlgsmtayalarlcyetlleygvlakrsveeksvtpalekiveantlls
    glgfesgglaaahaihngltvlenthkylhgekvaigvlaslfltdkprkmieevysfce
    evglpttlaeigldgvsdedlmkvaekacdknetihnepqpvtskdvffalkaadrygrm
    rknl