PDB entry 1kq2

View 1kq2 on RCSB PDB site
Description: Crystal Structure of an Hfq-RNA Complex
Class: translation/RNA
Keywords: Hfq-RNA complex, single-stranded RNA, translational regulator
Deposited on 2002-01-03, released 2002-07-05
The last revision prior to the SCOP 1.73 freeze date was dated 2002-07-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: 0.204
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq2a_
  • Chain 'B':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq2b_
  • Chain 'H':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq2h_
  • Chain 'I':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq2i_
  • Chain 'K':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq2k_
  • Chain 'M':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq2m_
  • Chain 'R':
    Compound: 5'-r(*ap*up*up*up*up*up*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kq2A (A:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq2A (A:)
    niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kq2B (B:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq2B (B:)
    niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
    e
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1kq2H (H:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq2H (H:)
    eniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistyt
    ve
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1kq2I (I:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq2I (I:)
    niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1kq2K (K:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq2K (K:)
    niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
    e
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1kq2M (M:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq2M (M:)
    niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
    e
    

  • Chain 'R':
    No sequence available.