PDB entry 1kq1

View 1kq1 on RCSB PDB site
Description: 1.55 A Crystal structure of the pleiotropic translational regulator, Hfq
Class: translation
Keywords: Hfq, hexamer, RNA binding protein, translational regulator, Sm motif
Deposited on 2002-01-03, released 2002-07-10
The last revision prior to the SCOP 1.73 freeze date was dated 2002-07-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.237
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq1a_
  • Chain 'B':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq1b_
  • Chain 'H':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq1h_
  • Chain 'I':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq1i_
  • Chain 'K':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq1k_
  • Chain 'M':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq1m_
  • Chain 'N':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq1n_
  • Chain 'R':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq1r_
  • Chain 'S':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq1s_
  • Chain 'T':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq1t_
  • Chain 'W':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq1w_
  • Chain 'Y':
    Compound: Host Factor for Q beta
    Species: Staphylococcus aureus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kq1y_
  • Heterogens: ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kq1A (A:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq1A (A:)
    niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kq1B (B:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq1B (B:)
    niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
    e
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1kq1H (H:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq1H (H:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytve
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1kq1I (I:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq1I (I:)
    niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1kq1K (K:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq1K (K:)
    niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
    e
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1kq1M (M:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq1M (M:)
    niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
    e
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1kq1N (N:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq1N (N:)
    niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
    e
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1kq1R (R:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq1R (R:)
    niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
    e
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1kq1S (S:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq1S (S:)
    niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
    e
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1kq1T (T:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq1T (T:)
    niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
    e
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1kq1W (W:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq1W (W:)
    niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv
    e
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1kq1Y (Y:)
    mianeniqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhai
    stytvetegqastesee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kq1Y (Y:)
    niqdkalenfkanqtevtvfflngfqmkgvieeydkyvvslnsqgkqhliykhaistytv