PDB entry 1kpq

View 1kpq on RCSB PDB site
Description: Structure of the Tsg101 UEV domain
Class: cell cycle
Keywords: e2 fold
Deposited on 2002-01-02, released 2002-05-25
The last revision prior to the SCOP 1.73 freeze date was dated 2002-05-25, with a file datestamp of 2007-06-04.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor susceptibility gene 101 protein
    Species: HOMO SAPIENS
    Gene: TSG101
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1kpqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kpqA (A:)
    mavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtip
    vpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhp
    qsdllgliqvmivvfgdeppvfsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kpqA (A:)
    avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipv
    pyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpq
    sdllgliqvmivvfgdeppvfsrp