PDB entry 1kpq

View 1kpq on RCSB PDB site
Description: structure of the tsg101 uev domain
Deposited on 2002-01-02, released 2002-05-25
The last revision prior to the SCOP 1.61 freeze date was dated 2002-05-25, with a file datestamp of 2002-05-25.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1kpqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpqA (A:)
    avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipv
    pyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpq
    sdllgliqvmivvfgdeppvfsrp