PDB entry 1kpq

View 1kpq on RCSB PDB site
Description: Structure of the Tsg101 UEV domain
Class: cell cycle
Keywords: e2 fold, cell cycle
Deposited on 2002-01-02, released 2002-05-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tumor susceptibility gene 101 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: TSG101
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kpqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kpqA (A:)
    mavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtip
    vpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhp
    qsdllgliqvmivvfgdeppvfsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kpqA (A:)
    avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipv
    pyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpq
    sdllgliqvmivvfgdeppvfsrp