PDB entry 1kpp

View 1kpp on RCSB PDB site
Description: Structure of the Tsg101 UEV domain
Deposited on 2002-01-02, released 2002-05-24
The last revision prior to the SCOP 1.69 freeze date was dated 2002-05-24, with a file datestamp of 2002-05-24.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1kppa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kppA (A:)
    mavsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtip
    vpyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhp
    qsdllgliqvmivvfgdeppvfsrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kppA (A:)
    avsesqlkkmvskykyrdltvretvnvitlykdlkpvldsyvfndgssrelmnltgtipv
    pyrgntynipiclwlldtypynppicfvkptssmtiktgkhvdangkiylpylhewkhpq
    sdllgliqvmivvfgdeppvfsrp