PDB entry 1kpm

View 1kpm on RCSB PDB site
Description: First Structural Evidence of a Specific Inhibition of Phospholipase A2 by Vitamin E and its Implications in Inflammation: Crystal Structure of the Complex Formed between Phospholipase A2 and Vitamin E at 1.8 A Resolution.
Class: hydrolase
Keywords: phospholipase A2, Daboia russelli pulchella, neurotoxic, inflammation, HYDROLASE
Deposited on 2002-01-01, released 2002-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kpma_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kpmb_
  • Heterogens: VIT, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpmA (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpmB (B:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c