PDB entry 1kpm
View 1kpm on RCSB PDB site
Description: First Structural Evidence of a Specific Inhibition of Phospholipase A2 by Vitamin E and its Implications in Inflammation: Crystal Structure of the Complex Formed between Phospholipase A2 and Vitamin E at 1.8 A Resolution.
Class: hydrolase
Keywords: phospholipase A2, Daboia russelli pulchella, neurotoxic, inflammation, HYDROLASE
Deposited on
2002-01-01, released
2002-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated
2017-10-11, with a file datestamp of
2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: phospholipase a2
Species: Daboia russellii pulchella [TaxId:97228]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1kpma_ - Chain 'B':
Compound: phospholipase a2
Species: Daboia russellii pulchella [TaxId:97228]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1kpmb_ - Heterogens: VIT, ACY, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1kpmA (A:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1kpmB (B:)
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c