PDB entry 1kpm

View 1kpm on RCSB PDB site
Description: first structural evidence of a specific inhibition of phospholipase a2 by vitamin e and its implications in inflammation: crystal structure of the complex formed between phospholipase a2 and vitamin e at 1.8 a resolution.
Deposited on 2002-01-01, released 2002-07-10
The last revision prior to the SCOP 1.69 freeze date was dated 2002-07-10, with a file datestamp of 2002-07-10.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1kpma_
  • Chain 'B':
    Domains in SCOP 1.69: d1kpmb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpmA (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kpmB (B:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c