PDB entry 1kpf

View 1kpf on RCSB PDB site
Description: pkci-substrate analog
Class: protein kinase inhibitor
Keywords: protein kinase inhibitor, pkci-1, hit protein family, histidine triad protein family, nucleotidyl hydrolase, nucleotidyl transferase
Deposited on 1997-09-25, released 1998-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.209
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein kinase c interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene: HPKCI-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kpfa_
  • Heterogens: AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kpfA (A:)
    adeiakaqvarpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhis
    qisvaedddesllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqm
    hwppg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kpfA (A:)
    dtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesllg
    hlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg