PDB entry 1kpa

View 1kpa on RCSB PDB site
Description: pkci-1-zinc
Class: protein kinase c interacting protein
Keywords: pkci-1, pkc, signal transduction, zinc binding protein, protein kinase c interacting protein
Deposited on 1996-01-06, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: human protein kinase c interacting protein 1 (zinc protein)
    Species: Homo sapiens [TaxId:9606]
    Gene: HPKCI-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kpaa_
  • Chain 'B':
    Compound: human protein kinase c interacting protein 1 (zinc protein)
    Species: Homo sapiens [TaxId:9606]
    Gene: HPKCI-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kpab_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kpaA (A:)
    adeiakaqvarpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhis
    qisvaedddesllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqm
    hwppg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kpaA (A:)
    ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
    lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kpaB (B:)
    adeiakaqvarpggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhis
    qisvaedddesllghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqm
    hwppg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kpaB (B:)
    ggdtifgkiirkeipakiifeddrclafhdispqapthflvipkkhisqisvaedddesl
    lghlmivgkkcaadlglnkgyrmvvnegsdggqsvyhvhlhvlggrqmhwppg