PDB entry 1kp8

View 1kp8 on RCSB PDB site
Description: Structural Basis for GroEL-assisted Protein Folding from the Crystal Structure of (GroEL-KMgATP)14 at 2.0 A Resolution
Class: chaperone
Keywords: chaperonin, GroEL, assisted protein folding, CHAPERONE
Deposited on 2001-12-30, released 2003-03-25
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-03-26, with a file datestamp of 2014-03-21.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.243
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (11)
      • see remark 999 (124)
      • see remark 999 (432)
    Domains in SCOPe 2.04: d1kp8a1, d1kp8a2, d1kp8a3
  • Chain 'B':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (11)
      • see remark 999 (124)
      • see remark 999 (432)
    Domains in SCOPe 2.04: d1kp8b1, d1kp8b2, d1kp8b3
  • Chain 'C':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (11)
      • see remark 999 (124)
      • see remark 999 (432)
    Domains in SCOPe 2.04: d1kp8c1, d1kp8c2, d1kp8c3
  • Chain 'D':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (11)
      • see remark 999 (124)
      • see remark 999 (432)
    Domains in SCOPe 2.04: d1kp8d1, d1kp8d2, d1kp8d3
  • Chain 'E':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (11)
      • see remark 999 (124)
      • see remark 999 (432)
    Domains in SCOPe 2.04: d1kp8e1, d1kp8e2, d1kp8e3
  • Chain 'F':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (11)
      • see remark 999 (124)
      • see remark 999 (432)
    Domains in SCOPe 2.04: d1kp8f1, d1kp8f2, d1kp8f3
  • Chain 'G':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (11)
      • see remark 999 (124)
      • see remark 999 (432)
    Domains in SCOPe 2.04: d1kp8g1, d1kp8g2, d1kp8g3
  • Chain 'H':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (11)
      • see remark 999 (124)
      • see remark 999 (432)
    Domains in SCOPe 2.04: d1kp8h1, d1kp8h2, d1kp8h3
  • Chain 'I':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (11)
      • see remark 999 (124)
      • see remark 999 (432)
    Domains in SCOPe 2.04: d1kp8i1, d1kp8i2, d1kp8i3
  • Chain 'J':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (11)
      • see remark 999 (124)
      • see remark 999 (432)
    Domains in SCOPe 2.04: d1kp8j1, d1kp8j2, d1kp8j3
  • Chain 'K':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (11)
      • see remark 999 (124)
      • see remark 999 (432)
    Domains in SCOPe 2.04: d1kp8k1, d1kp8k2, d1kp8k3
  • Chain 'L':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (11)
      • see remark 999 (124)
      • see remark 999 (432)
    Domains in SCOPe 2.04: d1kp8l1, d1kp8l2, d1kp8l3
  • Chain 'M':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (11)
      • see remark 999 (124)
      • see remark 999 (432)
    Domains in SCOPe 2.04: d1kp8m1, d1kp8m2, d1kp8m3
  • Chain 'N':
    Compound: groEL protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F5 (0-End)
      • see remark 999 (11)
      • see remark 999 (124)
      • see remark 999 (432)
    Domains in SCOPe 2.04: d1kp8n1, d1kp8n2, d1kp8n3
  • Heterogens: SO4, MG, K, AGS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kp8A (A:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp8A (A:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kp8B (B:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp8B (B:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kp8C (C:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp8C (C:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kp8D (D:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp8D (D:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1kp8E (E:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp8E (E:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1kp8F (F:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp8F (F:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1kp8G (G:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp8G (G:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1kp8H (H:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp8H (H:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1kp8I (I:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp8I (I:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1kp8J (J:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp8J (J:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1kp8K (K:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp8K (K:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1kp8L (L:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp8L (L:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1kp8M (M:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp8M (M:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1kp8N (N:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpkndaadlgaaggmggm
    ggmggmm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp8N (N:)
    aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
    ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
    kavtvaveelkalsvpcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgt
    glqdeldvvegmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleava
    kagkplliiaedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtvi
    seeigmelekatledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdyd
    reklqervaklaggvavikvgaatevemkekkarvedalhatraaveegvvagggvalir
    vaskladlrgqnadqnvgikvalrameaplrqivlncgeepsvvantvkggdgnygynaa
    teeygnmidmgildptkvtrsalqyaasvaglmittecmvtdlpk