PDB entry 1kp3

View 1kp3 on RCSB PDB site
Description: Crystal Structure of E. coli Argininosuccinate Synthetase in Complex with ATP and Citrulline
Class: ligase
Keywords: N-Type ATP pyrophosphatase, LIGASE
Deposited on 2001-12-27, released 2002-04-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Argininosuccinate Synthetase
    Species: Escherichia coli [TaxId:562]
    Gene: ARGG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kp3a1, d1kp3a2
  • Heterogens: PO4, ATP, CIR, GAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kp3A (A:)
    ttilkhlpvgqrigiafsggldtsaallwmrqkgavpyaytanlgqpdeedydaiprram
    eygaenarlidcrkqlvaegiaaiqcgafhnttggltyfnttplgravtgtmlvaamked
    gvniwgdgstykgndierfyryglltnaelqiykpwldtdfidelggrhemsefmiacgf
    dykmsvekaystdsnmlgatheakdleylnssvkivnpimgvkfwdesvkipaeevtvrf
    eqghpvalngktfsddvemmleanriggrhglgmsdqienriieaksrgiyeapgmallh
    iayerlltgihnedtieqyhahgrqlgrllyqgrwfdsqalmlrdslqrwvasqitgevt
    lelrrgndysilntvsenltykperltmekgdsvfspddrigqltmrnlditdtreklfg
    yaktgllsssaasgvpqvenlenkgqsvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kp3A (A:)
    ttilkhlpvgqrigiafsggldtsaallwmrqkgavpyaytanlgqpdeedydaiprram
    eygaenarlidcrkqlvaegiaaiqcgafhnttggltyfnttplgravtgtmlvaamked
    gvniwgdgstykgndierfyryglltnaelqiykpwldtdfidelggrhemsefmiacgf
    dykmsvekaystdsnmlgatheakdleylnssvkivnpimgvkfwdesvkipaeevtvrf
    eqghpvalngktfsddvemmleanriggrhglgmsdqienriieaksrgiyeapgmallh
    iayerlltgihnedtieqyhahgrqlgrllyqgrwfdsqalmlrdslqrwvasqitgevt
    lelrrgndysilntvsenltykpersvfspddrigqltmrnlditdtreklfgyaktgll
    sssaasgvpqvenlenkgq