PDB entry 1koz

View 1koz on RCSB PDB site
Description: solution structure of omega-grammotoxin sia
Class: toxin
Keywords: toxin, cystine knot
Deposited on 2001-12-25, released 2002-08-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Voltage-dependent Channel Inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1koza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kozA (A:)
    dcvrfwgkcsqtsdccphlackskwprnicvwdgsv