PDB entry 1kot

View 1kot on RCSB PDB site
Description: Solution Structure of Human GABA Receptor Associated Protein GABARAP
Class: transport protein
Keywords: human GABA Receptor Targeting GABARAP, TRANSPORT PROTEIN
Deposited on 2001-12-22, released 2002-01-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gabarap
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O95166 (2-118)
    • cloning artifact (0-1)
  Domains in SCOPe 2.05: d1kota_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kotA (A:)
  gsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvg
  qfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl