PDB entry 1kot

View 1kot on RCSB PDB site
Description: solution structure of human gaba receptor associated protein gabarap
Deposited on 2001-12-22, released 2002-01-16
The last revision prior to the SCOP 1.59 freeze date was dated 2002-01-16, with a file datestamp of 2002-01-16.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1kota_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kotA (A:)
  gsmkfvykeehpfekrrsegekirkkypdrvpvivekapkarigdldkkkylvpsdltvg
  qfyflirkrihlraedalfffvnnvipptsatmgqlyqehheedfflyiaysdesvygl