PDB entry 1kom

View 1kom on RCSB PDB site
Description: Solution NMR structure of the Archaebacterial Chromosomal Protein MC1
Deposited on 2001-12-21, released 2003-11-18
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-18, with a file datestamp of 2003-11-18.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1koma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1komA (A:)
    sntrnfvlrdedgnehgvftgkqprqaalkaanrgsgtkanpdiirlrergtkkvhvfka
    wkeivdapknrpawmpekiskpfvkkeriekle