PDB entry 1kom

View 1kom on RCSB PDB site
Description: Solution NMR structure of the Archaebacterial Chromosomal Protein MC1
Class: DNA binding protein
Keywords: beta-alpha-barrels
Deposited on 2001-12-21, released 2003-11-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2004-12-07, with a file datestamp of 2007-04-25.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Chromosomal protein MC1
  Species: Methanosarcina thermophila
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12770 (0-92)
  Domains in SCOPe 2.08: d1koma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1komA (A:)
  sntrnfvlrdedgnehgvftgkqprqaalkaanrgsgtkanpdiirlrergtkkvhvfka
  wkeivdapknrpawmpekiskpfvkkeriekle