PDB entry 1kol

View 1kol on RCSB PDB site
Description: Crystal structure of formaldehyde dehydrogenase
Deposited on 2001-12-21, released 2002-12-11
The last revision prior to the SCOP 1.71 freeze date was dated 2002-12-11, with a file datestamp of 2002-12-11.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.171
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kolA (A:)
    sgnrgvvylgsgkvevqkidypkmqdprgkkiehgvilkvvstnicgsdqhmvrgrttaq
    vglvlgheitgeviekgrdvenlqigdlvsvpfnvacgrcrsckemhtgvcltvnparag
    gaygyvdmgdwtggqaeyvlvpyadfnllklpdrdkamekirdltclsdilptgyhgavt
    agvgpgstvyvagagpvglaaaasarllgaavvivgdlnparlahakaqgfeiadlsldt
    plheqiaallgepevdcavdavgfearghghegakheapatvlnslmqvtrvagkigipg
    lyvtedpgavdaaakigslsirfglgwakshsfhtgqtpvmkynralmqaimwdriniae
    vvgvqvislddaprgygefdagvpkkfvidphktfsaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kolA (A:)
    gnrgvvylgsgkvevqkidypkmqdprgkkiehgvilkvvstnicgsdqhmvrgrttaqv
    glvlgheitgeviekgrdvenlqigdlvsvpfnvacgrcrsckemhtgvcltvnparagg
    aygyvdmgdwtggqaeyvlvpyadfnllklpdrdkamekirdltclsdilptgyhgavta
    gvgpgstvyvagagpvglaaaasarllgaavvivgdlnparlahakaqgfeiadlsldtp
    lheqiaallgepevdcavdavgfearghghegakheapatvlnslmqvtrvagkigipgl
    yvtedpgavdaaakigslsirfglgwakshsfhtgqtpvmkynralmqaimwdriniaev
    vgvqvislddaprgygefdagvpkkfvidphktfsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kolB (B:)
    sgnrgvvylgsgkvevqkidypkmqdprgkkiehgvilkvvstnicgsdqhmvrgrttaq
    vglvlgheitgeviekgrdvenlqigdlvsvpfnvacgrcrsckemhtgvcltvnparag
    gaygyvdmgdwtggqaeyvlvpyadfnllklpdrdkamekirdltclsdilptgyhgavt
    agvgpgstvyvagagpvglaaaasarllgaavvivgdlnparlahakaqgfeiadlsldt
    plheqiaallgepevdcavdavgfearghghegakheapatvlnslmqvtrvagkigipg
    lyvtedpgavdaaakigslsirfglgwakshsfhtgqtpvmkynralmqaimwdriniae
    vvgvqvislddaprgygefdagvpkkfvidphktfsaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kolB (B:)
    gnrgvvylgsgkvevqkidypkmqdprgkkiehgvilkvvstnicgsdqhmvrgrttaqv
    glvlgheitgeviekgrdvenlqigdlvsvpfnvacgrcrsckemhtgvcltvnparagg
    aygyvdmgdwtggqaeyvlvpyadfnllklpdrdkamekirdltclsdilptgyhgavta
    gvgpgstvyvagagpvglaaaasarllgaavvivgdlnparlahakaqgfeiadlsldtp
    lheqiaallgepevdcavdavgfearghghegakheapatvlnslmqvtrvagkigipgl
    yvtedpgavdaaakigslsirfglgwakshsfhtgqtpvmkynralmqaimwdriniaev
    vgvqvislddaprgygefdagvpkkfvidphktfsa