PDB entry 1kok

View 1kok on RCSB PDB site
Description: Crystal Structure of Mesopone Cytochrome c Peroxidase (MpCcP)
Class: oxidoreductase
Keywords: Bifunctional catalyst, Proximal loop, Trp191 cationic radical, mesoporphyrin, nitrite reducatse, cytochrome c peroxidase, cytochrome oxidase, OXIDOREDUCTASE
Deposited on 2001-12-20, released 2002-10-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: OPBYC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1koka_
  • Heterogens: HIF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kokA (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl