PDB entry 1kok

View 1kok on RCSB PDB site
Description: Crystal Structure of Mesopone Cytochrome c Peroxidase (MpCcP)
Deposited on 2001-12-20, released 2002-10-02
The last revision prior to the SCOP 1.69 freeze date was dated 2002-10-02, with a file datestamp of 2002-10-02.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.186
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1koka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kokA (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl