PDB entry 1koe

View 1koe on RCSB PDB site
Description: endostatin
Class: angiogenesis inhibitor
Keywords: angiogenesis inhibitor, collagen xviii, non-collageneous domain, heparin-binding domain
Deposited on 1998-01-22, released 1999-02-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-31, with a file datestamp of 2021-03-26.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: endostatin
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39061 (0-171)
  Domains in SCOPe 2.08: d1koea_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1koeA (A:)
  qpvlhlvalntplsggmrgirgadfqcfqqaravglsgtfraflssrlqdlysivrradr
  gsvpivnlkdevlspswdslfsgsqgqlqpgarifsfdgrdvlrhpawpqksvwhgsdps
  grrlmesycetwrtettgatgqassllsgrlleqkaaschnsyivlciensf