PDB entry 1kob

View 1kob on RCSB PDB site
Description: twitchin kinase fragment (aplysia), autoregulated protein kinase domain
Class: kinase
Keywords: kinase, twitchin, intrasteric regulation
Deposited on 1996-06-28, released 1997-03-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: twitchin
    Species: Aplysia californica [TaxId:6500]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16980
      • conflict (48)
      • conflict (79)
      • conflict (121)
    Domains in SCOPe 2.05: d1koba_
  • Chain 'B':
    Compound: twitchin
    Species: Aplysia californica [TaxId:6500]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16980
      • conflict (48)
      • conflict (79)
      • conflict (121)
    Domains in SCOPe 2.05: d1kobb_
  • Heterogens: VAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kobA (A:)
    mrgshhhhhhgskvrgkydgpkindydkfyediwkkyvpqpvevkqgsvydyydileelg
    sgafgvvhrcvekatgrvfvakfintpypldkytvkneisimnqlhhpklinlhdafedk
    yemvlileflsggelfdriaaedykmseaevinymrqaceglkhmhehsivhldikpeni
    mcetkkassvkiidfglatklnpdeivkvttataefaapeivdrepvgfytdmwaigvlg
    yvllsglspfageddletlqnvkrcdwefdedafssvspeakdfiknllqkeprkrltvh
    dalehpwlkgdhsnltsripssrynkirqkikekyadwpapqpaigrianfsslrkhrpq
    eyqiydsyfdrkeavprfklrpsliss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kobA (A:)
    indydkfyediwkkyvpqpvevkqgsvydyydileelgsgafgvvhrcvekatgrvfvak
    fintpypldkytvkneisimnqlhhpklinlhdafedkyemvlileflsggelfdriaae
    dykmseaevinymrqaceglkhmhehsivhldikpenimcetkkassvkiidfglatkln
    pdeivkvttataefaapeivdrepvgfytdmwaigvlgyvllsglspfageddletlqnv
    krcdwefdedafssvspeakdfiknllqkeprkrltvhdalehpwlkgdhsnltsripss
    rynkirqkikekyadwpapqpaigrianfsslrkhrpqeyqiydsyfdrkea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kobB (B:)
    mrgshhhhhhgskvrgkydgpkindydkfyediwkkyvpqpvevkqgsvydyydileelg
    sgafgvvhrcvekatgrvfvakfintpypldkytvkneisimnqlhhpklinlhdafedk
    yemvlileflsggelfdriaaedykmseaevinymrqaceglkhmhehsivhldikpeni
    mcetkkassvkiidfglatklnpdeivkvttataefaapeivdrepvgfytdmwaigvlg
    yvllsglspfageddletlqnvkrcdwefdedafssvspeakdfiknllqkeprkrltvh
    dalehpwlkgdhsnltsripssrynkirqkikekyadwpapqpaigrianfsslrkhrpq
    eyqiydsyfdrkeavprfklrpsliss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kobB (B:)
    indydkfyediwkkyvpqpvevkqgsvydyydileelgsgafgvvhrcvekatgrvfvak
    fintpypldkytvkneisimnqlhhpklinlhdafedkyemvlileflsggelfdriaae
    dykmseaevinymrqaceglkhmhehsivhldikpenimcetkkassvkiidfglatkln
    pdeivkvttataefaapeivdrepvgfytdmwaigvlgyvllsglspfageddletlqnv
    krcdwefdedafssvspeakdfiknllqkeprkrltvhdalehpwlkgdhsnltsripss
    rynkirqkikekyadwpapqpaigrianfsslrkhrpqeyqiydsyfdrkea