PDB entry 1ko9

View 1ko9 on RCSB PDB site
Description: Native Structure of the Human 8-oxoguanine DNA Glycosylase hOGG1
Class: hydrolase
Keywords: helix-hairpin-helix DNA-glycosylase, HYDROLASE
Deposited on 2001-12-20, released 2002-01-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.206
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 8-oxoguanine DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Gene: OGG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ko9a1, d1ko9a2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ko9A (A:)
    mparallprrmghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvla
    dqvwtltqteeqlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshf
    qevaqkfqgvrllrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhg
    fpslqalagpeveahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkal
    cilpgvgtkvadciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelg
    nffrslwgpyagwaqavlfsadlrqsrhaqeppakrrkgskgpeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ko9A (A:)
    ghrtlastpalwasipcprselrldlvlpsgqsfrwreqspahwsgvladqvwtltqtee
    qlhctvyrgdksqasrptpdeleavrkyfqldvtlaqlyhhwgsvdshfqevaqkfqgvr
    llrqdpieclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpslqalagpe
    veahlrklglgyraryvsasaraileeqgglawlqqlressyeeahkalcilpgvgtkva
    dciclmaldkpqavpvdvhmwhiaqrdyswhpttsqakgpspqtnkelgnffrslwgpya
    gwaqavlfsadl