PDB entry 1ko3

View 1ko3 on RCSB PDB site
Description: VIM-2, a Zn-beta-lactamase from Pseudomonas aeruginosa with Cys221 reduced
Class: hydrolase
Keywords: alpha-beta/beta-alpha fold, HYDROLASE
Deposited on 2001-12-20, released 2003-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.209
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: VIM-2 metallo-beta-lactamase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: blaVIM-2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ko3a_
  • Heterogens: ZN, ACT, CL, OH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ko3A (A:)
    eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
    taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
    thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
    adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtn