PDB entry 1ko2

View 1ko2 on RCSB PDB site
Description: VIM-2, a Zn-beta-lactamase from Pseudomonas aeruginosa with an oxidized Cys (cysteinesulfonic)
Class: hydrolase
Keywords: alpha-beta/beta-alpha fold, HYDROLASE
Deposited on 2001-12-20, released 2003-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: VIM-2 metallo-beta-lactamase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: blaVIM-2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K2N0 (0-229)
      • modified residue (166)
    Domains in SCOPe 2.08: d1ko2a_
  • Heterogens: ZN, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ko2A (A:)
eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtn