PDB entry 1knz

View 1knz on RCSB PDB site
Description: Recognition of the rotavirus mRNA 3' consensus by an asymmetric NSP3 homodimer
Class: Viral protein/RNA
Keywords: Protein-ssRNA complex, Viral protein/RNA COMPLEX
Deposited on 2001-12-19, released 2002-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.228
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nonstructural RNA-binding Protein 34
    Species: Rotavirus A [TaxId:10923]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1knza_
  • Chain 'B':
    Compound: Nonstructural RNA-binding Protein 34
    Species: Rotavirus A [TaxId:10923]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03536 (3-End)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d1knzb1, d1knzb2
  • Chain 'C':
    Compound: Nonstructural RNA-binding Protein 34
    Species: Rotavirus A [TaxId:10923]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1knzc_
  • Chain 'D':
    Compound: Nonstructural RNA-binding Protein 34
    Species: Rotavirus A [TaxId:10923]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03536 (3-End)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d1knzd1, d1knzd2
  • Chain 'I':
    Compound: Nonstructural RNA-binding Protein 34
    Species: Rotavirus A [TaxId:10923]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1knzi_
  • Chain 'J':
    Compound: Nonstructural RNA-binding Protein 34
    Species: Rotavirus A [TaxId:10923]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03536 (3-End)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d1knzj1, d1knzj2
  • Chain 'M':
    Compound: Nonstructural RNA-binding Protein 34
    Species: Rotavirus A [TaxId:10923]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1knzm_
  • Chain 'N':
    Compound: Nonstructural RNA-binding Protein 34
    Species: Rotavirus A [TaxId:10923]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03536 (3-End)
      • cloning artifact (1-2)
    Domains in SCOPe 2.07: d1knzn1, d1knzn2
  • Chain 'W':
    Compound: 5'-r(*up*gp*ap*cp*c)-3'
    Species:
    Gene:
  • Chain 'X':
    Compound: 5'-r(*up*gp*ap*cp*c)-3'
    Species:
    Gene:
  • Chain 'Y':
    Compound: 5'-r(*up*gp*ap*cp*c)-3'
    Species:
    Gene:
  • Chain 'Z':
    Compound: 5'-r(*up*gp*ap*cp*c)-3'
    Species:
    Gene:
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1knzA (A:)
    lgsmestqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvk
    nnpigkaitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlsskgidqkmrvl
    nacfsvkripgksssiikctklmrdklergevevddsfvdekme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1knzA (A:)
    tqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvknnpigk
    aitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlgidqkmrvlnacfsvkri
    pgksssiikctklmrdklergevevddsfvdekm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1knzB (B:)
    lgsmestqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvk
    nnpigkaitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlsskgidqkmrvl
    nacfsvkripgksssiikctklmrdklergevevddsfvdekme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1knzB (B:)
    gsmestqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvkn
    npigkaitidqalndtsrpakldedvnklrmmlsskgidqkmrvlnacfsvkripgksss
    iikctklmrdklergeve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1knzC (C:)
    lgsmestqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvk
    nnpigkaitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlsskgidqkmrvl
    nacfsvkripgksssiikctklmrdklergevevddsfvdekme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1knzC (C:)
    tqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvknnpigk
    aitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlgidqkmrvlnacfsvkri
    pgksssiikctklmrdklergevevddsfvdekm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1knzD (D:)
    lgsmestqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvk
    nnpigkaitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlsskgidqkmrvl
    nacfsvkripgksssiikctklmrdklergevevddsfvdekme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1knzD (D:)
    gsmestqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvkn
    npigkaitidqalndtsrpakldedvnklrmmlsskgidqkmrvlnacfsvkripgksss
    iikctklmrdklergeve
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1knzI (I:)
    lgsmestqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvk
    nnpigkaitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlsskgidqkmrvl
    nacfsvkripgksssiikctklmrdklergevevddsfvdekme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1knzI (I:)
    tqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvknnpigk
    aitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlgidqkmrvlnacfsvkri
    pgksssiikctklmrdklergevevddsfvdekm
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1knzJ (J:)
    lgsmestqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvk
    nnpigkaitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlsskgidqkmrvl
    nacfsvkripgksssiikctklmrdklergevevddsfvdekme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1knzJ (J:)
    gsmestqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvkn
    npigkaitidqalndtsrpakldedvnklrmmlsskgidqkmrvlnacfsvkripgksss
    iikctklmrdklergeve
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1knzM (M:)
    lgsmestqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvk
    nnpigkaitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlsskgidqkmrvl
    nacfsvkripgksssiikctklmrdklergevevddsfvdekme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1knzM (M:)
    tqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvknnpigk
    aitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlgidqkmrvlnacfsvkri
    pgksssiikctklmrdklergevevddsfvdekm
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1knzN (N:)
    lgsmestqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvk
    nnpigkaitidqalnnkfgsairnrnwladtsrpakldedvnklrmmlsskgidqkmrvl
    nacfsvkripgksssiikctklmrdklergevevddsfvdekme
    

    Sequence, based on observed residues (ATOM records): (download)
    >1knzN (N:)
    gsmestqqmavsiinssfeaavvaatsalenmgieydyqdiysrvknkfdfvmddsgvkn
    npigkaitidqalndtsrpakldedvnklrmmlsskgidqkmrvlnacfsvkripgksss
    iikctklmrdklergeve
    

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.