PDB entry 1knw

View 1knw on RCSB PDB site
Description: Crystal structure of diaminopimelate decarboxylase
Class: lyase
Keywords: pyridoxal-phosphate, decarboxylation, diaminopimelate, lysine, TIM-barrel, LYASE
Deposited on 2001-12-19, released 2003-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.173
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diaminopimelate decarboxylase
    Species: Escherichia coli [TaxId:562]
    Gene: LysA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00861 (Start-419)
      • expression tag (420-421)
    Domains in SCOPe 2.08: d1knwa1, d1knwa2, d1knwa3
  • Heterogens: SO4, LI, PLP, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1knwA (A:)
    mphslfstdtdltaenllrlpaefgcpvwvydaqiirrqiaalkqfdvvrfaqkacsnih
    ilrlmreqgvkvdsvslgeieralaagynpqthpddivftadvidqatlervselqipvn
    agsvdmldqlgqvspghrvwlrvnpgfghghsqktntggenskhgiwytdlpaaldviqr
    hhlqlvgihmhigsgvdyahleqvcgamvrqviefgqdlqaisaggglsvpyqqgeeavd
    tehyyglwnaareqiarhlghpvkleiepgrflvaqsgvlitqvrsvkqmgsrhfvlvda
    gfndlmrpamygsyhhisalaadgrslehaptvetvvagplcesgdvftqqeggnvetra
    lpevkagdylvlhdtgaygasmssnynsrpllpevlfdngqarlirrrqtieellalell
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1knwA (A:)
    phslfstdtdltaenllrlpaefgcpvwvydaqiirrqiaalkqfdvvrfaqkacsnihi
    lrlmreqgvkvdsvslgeieralaagynpqthpddivftadvidqatlervselqipvna
    gsvdmldqlgqvspghrvwlrvnpgfghghsqktntggenskhgiwytdlpaaldviqrh
    hlqlvgihmhigsgvdyahleqvcgamvrqviefgqdlqaisaggglsvpyqqgeeavdt
    ehyyglwnaareqiarhlghpvkleiepgrflvaqsgvlitqvrsvkqmgsrhfvlvdag
    fndlmrpamygsyhhisalaadgrslehaptvetvvagplcesgdvftqqeggnvetral
    pevkagdylvlhdtgaygasmssnynsrpllpevlfdngqarlirrrqtieellalellh
    h