PDB entry 1knt

View 1knt on RCSB PDB site
Description: the 1.6 angstroms structure of the kunitz-type domain from the alpha3 chain of the human type vi collagen
Deposited on 1994-08-18, released 1994-11-01
The last revision prior to the SCOP 1.55 freeze date was dated 1994-11-01, with a file datestamp of 1994-11-11.
Experiment type: -
Resolution: 1.6 Å
R-factor: 0.189
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1knt__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1knt_ (-)
    tdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvca