PDB entry 1knt

View 1knt on RCSB PDB site
Description: the 1.6 angstroms structure of the kunitz-type domain from the alpha3 chain of the human type vi collagen
Class: collagen type vi fragment
Keywords: collagen type vi fragment
Deposited on 1994-08-18, released 1994-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.189
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: collagen type vi
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12111
  Domains in SCOPe 2.08: d1knta_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1kntA (A:)
  etdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvcapv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1kntA (A:)
  tdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvca