PDB entry 1knp

View 1knp on RCSB PDB site
Description: E. coli L-aspartate oxidase: mutant R386L in complex with succinate
Class: oxidoreductase
Keywords: fumarate reductase family of oxidoreductases
Deposited on 2001-12-19, released 2002-04-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.233
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-aspartate oxidase
    Species: Escherichia coli [TaxId:562]
    Gene: NADB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10902
      • engineered (385)
    Domains in SCOPe 2.06: d1knpa1, d1knpa2, d1knpa3
  • Heterogens: NA, FAD, SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1knpA (A:)
    mntlpehscdvliigsgaaglslalrladqhqvivlskgpvtegstfyaqggiaavfdet
    dsidshvedtliagagicdrhavefvasnarscvqwlidqgvlfdthiqpngeesyhltr
    egghshrrilhaadatgrevettlvskalnhpnirvlertnavdlivsdkiglpgtrrvv
    gawvwnrnketvetchakavvlatggaskvyqyttnpdissgdgiamawragcrvanlef
    nqfhptalyhpqarnflltealrgegaylkrpdgtrfmpdfdergelaprdivaraidhe
    mkrlgadcmfldishkpadfirqhfpmiyekllglgidltqepvpivpaahytcggvmvd
    dhgrtdveglyaigevsytglhganlmasnslleclvygwsaaeditrrmpyahdistlp
    pwdesrvenpdervviqhnwhelrlfmwdyvgivrttkrleralrritmlqqeideyyah
    frvsnnllelrnlvqvaelivrcammrkesrglhftldypellthsgpsilspgnhyinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1knpA (A:)
    pehscdvliigsgaaglslalrladqhqvivlskgpvtegstfyaqggiaavfdetdsid
    shvedtliagagicdrhavefvasnarscvqwlidqgvlfdthiqpngeesyhltreggh
    shrrilhaadatgrevettlvskalnhpnirvlertnavdlivsdkiglpgtrrvvgawv
    wnrnketvetchakavvlatggaskvyqyttnpdissgdgiamawragcrvanlefnqfh
    ptalyhpqarnflltealrgegaylkrpdgtrfmpdfdergelaprdivaraidhemkrl
    gadcmfldishkpadfirqhfpmiyekllglgidltqepvpivpaahytcggvmvddhgr
    tdveglyaigevsytglhganlmasnslleclvygwsaaeditrrmpyahdistlppwde
    srvenpdervviqhnwhelrlfmwdyvgivrttkrleralrritmlqqeideyyahfrvs
    nnllelrnlvqvaelivrcammrkesrglhftldypellthsgpsilsp