PDB entry 1kno

View 1kno on RCSB PDB site
Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes
Class: catalytic antibody
Keywords: catalytic antibody
Deposited on 1995-09-11, released 1996-01-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.2
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg2a fab fragment cnj206
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAG43418 (3-213)
      • conflict (27)
      • conflict (29-31)
      • conflict (33)
      • conflict (38)
      • conflict (49-50)
      • conflict (52)
      • conflict (83)
      • conflict (95)
      • insertion (98)
      • conflict (101-106)
    Domains in SCOPe 2.06: d1knoa1, d1knoa2
  • Chain 'B':
    Compound: igg2a fab fragment cnj206
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC98952 (0-219)
      • conflict (12)
      • conflict (17)
      • conflict (29)
      • conflict (31-32)
      • conflict (34)
      • conflict (39)
      • conflict (43)
      • conflict (49)
      • conflict (51)
      • conflict (54-55)
      • insertion (57)
      • conflict (58)
      • conflict (60)
      • conflict (64)
      • conflict (74)
      • conflict (79)
      • conflict (81)
      • conflict (83)
      • insertion (98)
      • conflict (100-102)
      • conflict (104-106)
    Domains in SCOPe 2.06: d1knob1, d1knob2
  • Chain 'C':
    Compound: igg2a fab fragment cnj206
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAG43418 (3-213)
      • conflict (27)
      • conflict (29-31)
      • conflict (33)
      • conflict (38)
      • conflict (49-50)
      • conflict (52)
      • conflict (83)
      • conflict (95)
      • insertion (98)
      • conflict (101-106)
    Domains in SCOPe 2.06: d1knoc1, d1knoc2
  • Chain 'D':
    Compound: igg2a fab fragment cnj206
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC98952 (0-219)
      • conflict (12)
      • conflict (17)
      • conflict (29)
      • conflict (31-32)
      • conflict (34)
      • conflict (39)
      • conflict (43)
      • conflict (49)
      • conflict (51)
      • conflict (54-55)
      • insertion (57)
      • conflict (58)
      • conflict (60)
      • conflict (64)
      • conflict (74)
      • conflict (79)
      • conflict (81)
      • conflict (83)
      • insertion (98)
      • conflict (100-102)
      • conflict (104-106)
    Domains in SCOPe 2.06: d1knod1, d1knod2
  • Chain 'E':
    Compound: igg2a fab fragment cnj206
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAG43418 (3-213)
      • conflict (27)
      • conflict (29-31)
      • conflict (33)
      • conflict (38)
      • conflict (49-50)
      • conflict (52)
      • conflict (83)
      • conflict (95)
      • insertion (98)
      • conflict (101-106)
    Domains in SCOPe 2.06: d1knoe1, d1knoe2
  • Chain 'F':
    Compound: igg2a fab fragment cnj206
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAC98952 (0-219)
      • conflict (12)
      • conflict (17)
      • conflict (29)
      • conflict (31-32)
      • conflict (34)
      • conflict (39)
      • conflict (43)
      • conflict (49)
      • conflict (51)
      • conflict (54-55)
      • insertion (57)
      • conflict (58)
      • conflict (60)
      • conflict (64)
      • conflict (74)
      • conflict (79)
      • conflict (81)
      • conflict (83)
      • insertion (98)
      • conflict (100-102)
      • conflict (104-106)
    Domains in SCOPe 2.06: d1knof1, d1knof2
  • Heterogens: ZN, PNP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1knoA (A:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1knoB (B:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1knoC (C:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1knoD (D:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1knoE (E:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1knoF (F:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg