PDB entry 1kno

View 1kno on RCSB PDB site
Description: crystal structure of the complex of a catalytic antibody fab with a transition state analog: structural similarities in esterase-like abzymes
Deposited on 1995-09-11, released 1996-01-29
The last revision prior to the SCOP 1.69 freeze date was dated 1996-01-29, with a file datestamp of 1996-01-31.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.2
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1knoA (A:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1knoB (B:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1knoC (C:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1knoD (D:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1knoE (E:)
    qiqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasspytfgggtkleilradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1knoF (F:)
    dvklvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtamyycargdyygsrgaywgqgtlvtvsaa
    kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg