PDB entry 1kng

View 1kng on RCSB PDB site
Description: Crystal structure of CcmG reducing oxidoreductase at 1.14 A
Class: oxidoreductase
Keywords: thioredoxin fold, cytochrome c maturation, atomic resolution
Deposited on 2001-12-18, released 2002-07-17
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: 0.118
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thiol:disulfide interchange protein cycy
    Species: Bradyrhizobium japonicum
    Gene: cycy
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1knga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kngA (A:)
    dpsripsaligrpapqtalppleglqadnvqvpgldpaafkgkvslvnvwaswcvpchde
    aplltelgkdkrfqlvginykdaadnarrflgrygnpfgrvgvdangrasiewgvygvpe
    tfvvgregtivyklvgpitpdnlrsvllpqmekalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kngA (A:)
    rpapqtalppleglqadnvqvpgldpaafkgkvslvnvwaswcvpchdeaplltelgkdk
    rfqlvginykdaadnarrflgrygnpfgrvgvdangrasiewgvygvpetfvvgregtiv
    yklvgpitpdnlrsvllpqmekal