PDB entry 1kng

View 1kng on RCSB PDB site
Description: Crystal structure of CcmG reducing oxidoreductase at 1.14 A
Deposited on 2001-12-18, released 2002-07-17
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-17, with a file datestamp of 2002-07-17.
Experiment type: XRAY
Resolution: 1.14 Å
R-factor: 0.118
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1knga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kngA (A:)
    rpapqtalppleglqadnvqvpgldpaafkgkvslvnvwaswcvpchdeaplltelgkdk
    rfqlvginykdaadnarrflgrygnpfgrvgvdangrasiewgvygvpetfvvgregtiv
    yklvgpitpdnlrsvllpqmekal