PDB entry 1kne

View 1kne on RCSB PDB site
Description: chromo domain of hp1 complexed with histone h3 tail containing trimethyllysine 9
Deposited on 2001-12-18, released 2002-03-20
The last revision prior to the SCOP 1.71 freeze date was dated 2002-03-20, with a file datestamp of 2002-03-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.246
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1knea_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1kneA (A:)
mkkhhhhhhaeeeeeeyavekiidrrvrkgmveyylkwkgypetentwepennldcqdli
qqyeasrkd

    Sequence, based on observed residues (ATOM records): (download) 
    >1kneA (A:)
eyavekiidrrvrkgmveyylkwkgypetentwepennldcqdliqqyeasr