PDB entry 1knd

View 1knd on RCSB PDB site
Description: Crystal Structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase Complexed with Catechol under Anaerobic Condition
Deposited on 2001-12-18, released 2002-03-27
The last revision prior to the SCOP 1.65 freeze date was dated 2002-03-27, with a file datestamp of 2002-03-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.164
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kndA (A:)
    sirslgymgfavsdvaawrsfltqklglmeagttdngdlfridsrawriavqqgevddla
    fagyevadaaglaqmadklkqagiavttgdaslarrrgvtglitfadpfglpleiyygas
    evfekpflpgaavsgfltgeqglghfvrcvpdsdkalafytdvlgfqlsdvidmkmgpdv
    tvpayflhcnerhhtlaiaafplpkrihhfmlevaslddvgfafdrvdadglitstlgrh
    tndhmvsfyastpsgveveygwsartvdrswvvvrhdspsmwghksvrdkaaarnka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kndA (A:)
    sirslgymgfavsdvaawrsfltqklglmeagttdngdlfridsrawriavqqgevddla
    fagyevadaaglaqmadklkqagiavttgdaslarrrgvtglitfadpfglpleiyygas
    evfekpflpgaavsgfltgeqglghfvrcvpdsdkalafytdvlgfqlsdvidmkmgpdv
    tvpayflhcnerhhtlaiaafplpkrihhfmlevaslddvgfafdrvdadglitstlgrh
    tndhmvsfyastpsgveveygwsartvdrswvvvrhdspsmwghksvr